View the peptide-receptor complex
|
PDB code: 148L Peptide ID: 148l_S Representation: Peptide: ball and stick Protein: cartoon Download files: receptor.pdb peptide.pdb complex.pdb binding data |
Protein style
Protein color
Pure Rainbow Peptide style Peptide color Pure Rainbow Action |
Interacting peptide residues:
| S: 166, 167, 169, 170, |
Interacting receptor residues:
| E: 105, 106, 110, 113, 114, 115, 116, 117, 132, 133, 135, 136, 137, 138, 141, 142, |
Peptide sequence:
| >S AXXX |
Receptor sequence(s):
| >E MNIFEMLRIDEGLRLKIYKDTEGYYEIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALI NMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYKN |
The pepBDB database is updated monthly. Current version: 2020-03-18