View the peptide-receptor complex
|
PDB code: 1A2C Peptide ID: 1a2c_I Representation: Peptide: ball and stick Protein: cartoon Download files: receptor.pdb peptide.pdb complex.pdb binding data |
Protein style
Protein color
Pure Rainbow Peptide style Peptide color Pure Rainbow Action |
Interacting peptide residues:
| I: 355, 356, 357, 358, 359, 360, 363, 364, |
Interacting receptor residues:
| H: 32, 34, 36, 38, 39, 40, 65, 67, 73, 74, 75, 76, 80, 81, 82, 84, 151, |
Peptide sequence:
| >I DFEEIPEEXL |
Receptor sequence(s):
| >H IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDI ALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKETGQPSVLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDSGG PFVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDQFGE |
The pepBDB database is updated monthly. Current version: 2020-03-18