View the peptide-receptor complex
PDB code: 1A08 Peptide ID: 1a08_C Representation: Peptide: ball and stick Protein: cartoon Download files: receptor.pdb peptide.pdb complex.pdb binding data |
Protein style
Protein color
Pure Rainbow Peptide style Peptide color Pure Rainbow Action |
C: 101, 102, 103, |
A: 158, 178, 179, 180, 181, 182, 183, 187, 188, 203, 204, 205, 206, 217, 218, 239, 240, |
>C XEX |
>A SIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRL TTVCP |