View the peptide-receptor complex
|
PDB code: 1A1C Peptide ID: 1a1c_C Representation: Peptide: ball and stick Protein: cartoon Download files: receptor.pdb peptide.pdb complex.pdb binding data |
Protein style
Protein color
Pure Rainbow Peptide style Peptide color Pure Rainbow Action |
Interacting peptide residues:
| C: 101, 102, 103, |
Interacting receptor residues:
| A: 158, 178, 179, 180, 181, 182, 188, 203, 204, 205, 206, 217, 218, 238, 239, 240, B: 160, 164, |
Peptide sequence:
| >C XEX |
Receptor sequence(s):
| >A SIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRL TTVCP >B IQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLT TVCP |
The pepBDB database is updated monthly. Current version: 2020-03-18