View the peptide-receptor complex
|
PDB code: 1A1R Peptide ID: 1a1r_C Representation: Peptide: ball and stick Protein: cartoon Download files: receptor.pdb peptide.pdb complex.pdb binding data |
Protein style
Protein color
Pure Rainbow Peptide style Peptide color Pure Rainbow Action |
Interacting peptide residues:
| C: 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 34, 35, 36, |
Interacting receptor residues:
| A: 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 68, 69, 85, 88, 89, 90, 91, 96, 111, 114, 115, 116, 120, 133, 134, 135, 136, 137, 168, 170, 174, |
Peptide sequence:
| >C GSVVIVGRIVLSGKPA |
Receptor sequence(s):
| >A VEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLS PRPISYLKGSSGGPLLCPTGHAVGLFRAAVCTRGVAKAVDFIPVENLETTMR |
The pepBDB database is updated monthly. Current version: 2020-03-18