View the peptide-receptor complex
|
PDB code: 1A2C Peptide ID: 1a2c_J Representation: Peptide: ball and stick Protein: cartoon Download files: receptor.pdb peptide.pdb complex.pdb binding data |
Protein style
Protein color
Pure Rainbow Peptide style Peptide color Pure Rainbow Action |
Interacting peptide residues:
| J: 1, 2, 3, 4, |
Interacting receptor residues:
| H: 57, 60, 99, 146, 174, 189, 190, 191, 192, 193, 194, 195, 213, 214, 215, 216, 217, 219, 220, 221, 225, 226, 227, |
Peptide sequence:
| >J XLXX |
Receptor sequence(s):
| >H IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDI ALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKETGQPSVLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDSGG PFVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDQFGE |
The pepBDB database is updated monthly. Current version: 2020-03-18