View the peptide-receptor complex
|
PDB code: 1A2X Peptide ID: 1a2x_B Representation: Peptide: ball and stick Protein: cartoon Download files: receptor.pdb peptide.pdb complex.pdb binding data |
Protein style
Protein color
Pure Rainbow Peptide style Peptide color Pure Rainbow Action |
Interacting peptide residues:
| B: 4, 7, 8, 10, 11, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 24, 25, 26, 28, 29, 32, |
Interacting receptor residues:
| A: 12, 14, 15, 17, 18, 21, 90, 95, 97, 98, 100, 101, 102, 104, 115, 118, 119, 121, 122, 124, 125, 126, 130, 133, 134, 137, 151, 154, 155, 158, 159, |
Peptide sequence:
| >B EEKRNRAITARRQHLKSVMLQIAATELEKEE |
Receptor sequence(s):
| >A DQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAECFRI FDRNADGYIDAEELAEIFRASGEHVTDEEIESLMKDGDKNNDGRIDFDEFLKMMEGVQ |
The pepBDB database is updated monthly. Current version: 2020-03-18