View the peptide-receptor complex
|
PDB code: 1A37 Peptide ID: 1a37_P Representation: Peptide: ball and stick Protein: cartoon Download files: receptor.pdb peptide.pdb complex.pdb binding data |
Protein style
Protein color
Pure Rainbow Peptide style Peptide color Pure Rainbow Action |
Interacting peptide residues:
| P: 256, 257, 258, 259, 260, 261, 262, |
Interacting receptor residues:
| A: 46, 49, 56, 60, 124, 127, 128, 169, 172, 173, 176, 179, 220, 224, 227, 228, |
Peptide sequence:
| >P RSTXTPN |
Receptor sequence(s):
| >A MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQEKKQQMAREYREKIETELRDICNDVLSLLEKFL IPNAAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKIRLGLALNFSVFYYACSLAKTAFDEAIADDSTLIMQLLRDNLTLW |
The pepBDB database is updated monthly. Current version: 2020-03-18