View the peptide-receptor complex
|
PDB code: 1A38 Peptide ID: 1a38_P Representation: Peptide: ball and stick Protein: cartoon Download files: receptor.pdb peptide.pdb complex.pdb binding data |
Protein style
Protein color
Pure Rainbow Peptide style Peptide color Pure Rainbow Action |
Interacting peptide residues:
| P: 1, 2, 3, 4, 5, |
Interacting receptor residues:
| A: 41, 42, 45, 49, 56, 60, 117, 120, 124, 127, 128, 165, 166, 169, 170, 172, 173, 180, 217, 220, |
Peptide sequence:
| >P WLDLE |
Receptor sequence(s):
| >A MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQEKKQQMAREYREKIETELRDICNDVLSLLEKFL IPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAESYK DSTLIMQLLRDNLTLW |
The pepBDB database is updated monthly. Current version: 2020-03-18