View the peptide-receptor complex
|
PDB code: 1A3B Peptide ID: 1a3b_I Representation: Peptide: ball and stick Protein: cartoon Download files: receptor.pdb peptide.pdb complex.pdb binding data |
Protein style
Protein color
Pure Rainbow Peptide style Peptide color Pure Rainbow Action |
Interacting peptide residues:
| I: 10, 11, 12, 13, 14, 15, 18, 19, |
Interacting receptor residues:
| H: 32, 34, 38, 39, 40, 65, 67, 73, 74, 75, 76, 82, 84, |
Peptide sequence:
| >I GDFEEIPEEYL |
Receptor sequence(s):
| >H IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDI ALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKETKGQPSVLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDSG GPFVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDQF |
The pepBDB database is updated monthly. Current version: 2020-03-18