View the peptide-receptor complex
|
PDB code: 1A5H Peptide ID: 1a5h_C Representation: Peptide: ball and stick Protein: cartoon Download files: receptor.pdb peptide.pdb complex.pdb binding data |
Protein style
Protein color
Pure Rainbow Peptide style Peptide color Pure Rainbow Action |
Interacting peptide residues:
| C: 1, 2, 3, 4, 5, 6, |
Interacting receptor residues:
| A: 25, 26, 27, 28, 29, 114, 116, 119, 120, 121, 122, 137, 157, 205, 206, 207, |
Peptide sequence:
| >C TCGLRQY |
Receptor sequence(s):
| >A IKGGLFADIASHPWQAAIFAKHRRSPGERFLCGGILISSCWILSAAHCFQERFPPHHLTVILGRTYRVVPGEEEQKFEVEKYIVHKEFDDDTYDNDIALL QLKSDSSRCAQESSVVRTVCLPPADLQLPDWTECELSGYGKHEALSPFYSERLKEAHVRLYPSSRCTSQHLLNRTVTDNMLCAGDTRSGGPQANLHDACQ GDSGGPLVCLNDGRMTLVGIISWGLGCGQKDVPGVYTKVTNYLDWIRDNMRP |
The pepBDB database is updated monthly. Current version: 2020-03-18