View the peptide-receptor complex
|
PDB code: 1A6B Peptide ID: 1a6b_B Representation: Peptide: ball and stick Protein: cartoon Download files: receptor.pdb peptide.pdb complex.pdb binding data |
Protein style
Protein color
Pure Rainbow Peptide style Peptide color Pure Rainbow Action |
Interacting peptide residues:
| B: 21, 22, 23, 24, 25, 26, 27, 28, 34, 35, 36, 37, 42, 44, |
Interacting receptor residues:
| A: 1, 2, 3, 4, 5, |
Peptide sequence:
| >B GERRRSQLDRDQCAYCKEKGHWAKDCPKKPRGPRGPRPQT |
Receptor sequence(s):
| >A ACGCC |
The pepBDB database is updated monthly. Current version: 2020-03-18