View the peptide-receptor complex
|
PDB code: 1ABO Peptide ID: 1abo_C Representation: Peptide: ball and stick Protein: cartoon Download files: receptor.pdb peptide.pdb complex.pdb binding data |
Protein style
Protein color
Pure Rainbow Peptide style Peptide color Pure Rainbow Action |
Interacting peptide residues:
| C: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, |
Interacting receptor residues:
| A: 70, 72, 75, 76, 77, 79, 94, 98, 99, 110, 112, 114, 115, |
Peptide sequence:
| >C APTMPPPLPP |
Receptor sequence(s):
| >A NLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVNS |
The pepBDB database is updated monthly. Current version: 2020-03-18