View the peptide-receptor complex
|
PDB code: 1ABT Peptide ID: 1abt_B Representation: Peptide: ball and stick Protein: cartoon Download files: receptor.pdb peptide.pdb complex.pdb binding data |
Protein style
Protein color
Pure Rainbow Peptide style Peptide color Pure Rainbow Action |
Interacting peptide residues:
| B: 75, 76, 77, 78, 79, 80, |
Interacting receptor residues:
| A: 6, 7, 8, 9, 10, 11, 16, 18, 19, 32, 37, 38, 39, 40, 41, 42, 43, 44, 68, |
Peptide sequence:
| >B KHWVYY |
Receptor sequence(s):
| >A IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG |
The pepBDB database is updated monthly. Current version: 2020-03-18