View the peptide-receptor complex
|
PDB code: 1AFO Peptide ID: 1afo_A Representation: Peptide: ball and stick Protein: cartoon Download files: receptor.pdb peptide.pdb complex.pdb binding data |
Protein style
Protein color
Pure Rainbow Peptide style Peptide color Pure Rainbow Action |
Interacting peptide residues:
| A: 72, 73, 75, 76, 79, 80, 82, 83, 84, 87, 88, 91, |
Interacting receptor residues:
| B: 64, 72, 75, 76, 79, 80, 82, 83, 84, 87, 88, 91, |
Peptide sequence:
| >A VQLAHHFSEPEITLIIFGVMAGVIGTILLISYGIRRLIKK |
Receptor sequence(s):
| >B VQLAHHFSEPEITLIIFGVMAGVIGTILLISYGIRRLIKK |
The pepBDB database is updated monthly. Current version: 2020-03-18