View the peptide-receptor complex
|
PDB code: 1AI0 Peptide ID: 1ai0_B Representation: Peptide: ball and stick Protein: cartoon Download files: receptor.pdb peptide.pdb complex.pdb binding data |
Protein style
Protein color
Pure Rainbow Peptide style Peptide color Pure Rainbow Action |
Interacting peptide residues:
| B: 4, 5, 9, 12, 13, 16, 17, 20, 21, 22, 23, 24, 25, 26, 27, 28, |
Interacting receptor residues:
| D: 4, 5, 9, 12, 13, 16, 17, 21, 22, 23, 24, 25, 26, 27, 28, |
Peptide sequence:
| >B FVNQHLCGSHLVEALYLVCGERGFFYTPKT |
Receptor sequence(s):
| >D FVNQHLCGSHLVEALYLVCGERGFFYTPKT |
The pepBDB database is updated monthly. Current version: 2020-03-18