View the peptide-receptor complex
PDB code: 1AIK Peptide ID: 1aik_N Representation: Peptide: ball and stick Protein: cartoon Download files: receptor.pdb peptide.pdb complex.pdb binding data |
Protein style
Protein color
Pure Rainbow Peptide style Peptide color Pure Rainbow Action |
N: 546, 547, 548, 550, 551, 554, 555, 557, 558, 561, 562, 564, 565, 568, 569, 571, 572, 575, 576, 579, |
C: 628, 631, 634, 635, 638, 639, 641, 642, 645, 648, 649, 650, 652, 653, 656, 659, |
>N SGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARIL |
>C WMEWDREINNYTSLIHSLIEESQNQQEKNEQELL |