View the peptide-receptor complex
|
PDB code: 1AL2 Peptide ID: 1al2_0 Representation: Peptide: ball and stick Protein: cartoon Download files: receptor.pdb peptide.pdb complex.pdb binding data |
Protein style
Protein color
Pure Rainbow Peptide style Peptide color Pure Rainbow Action |
Interacting peptide residues:
| 0: 6, 7, 8, 9, 10, |
Interacting receptor residues:
| 4: 2, 3, 4, 5, 6, 7, 44, |
Peptide sequence:
| >0 GSSST |
Receptor sequence(s):
| >4 GAQVSSQKVGAHESTINYTTINYYRDSASNAASKQDFSQDPSKFTEPIKDVLIKTAPMLN |
The pepBDB database is updated monthly. Current version: 2020-03-18