View the peptide-receptor complex
|
PDB code: 1AOU Peptide ID: 1aou_P Representation: Peptide: ball and stick Protein: cartoon Download files: receptor.pdb peptide.pdb complex.pdb binding data |
Protein style
Protein color
Pure Rainbow Peptide style Peptide color Pure Rainbow Action |
Interacting peptide residues:
| P: 204, 205, 206, 207, 208, |
Interacting receptor residues:
| F: 12, 13, 14, 34, 35, 36, 37, 38, 44, 47, 59, 60, 61, 62, 73, 74, 75, 76, 95, 96, |
Peptide sequence:
| >P EPQXEEIPIYL |
Receptor sequence(s):
| >F SIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLSSRL VVPSHK |
The pepBDB database is updated monthly. Current version: 2020-03-18