View the peptide-receptor complex
|
PDB code: 1APT Peptide ID: 1apt_I Representation: Peptide: ball and stick Protein: cartoon Download files: receptor.pdb peptide.pdb complex.pdb binding data |
Protein style
Protein color
Pure Rainbow Peptide style Peptide color Pure Rainbow Action |
Interacting peptide residues:
| I: 1, 2, 3, 4, |
Interacting receptor residues:
| E: 15, 16, 31, 33, 35, 36, 74, 75, 76, 77, 79, 112, 121, 190, 211, 213, 215, 216, 217, 218, 220, 274, 284, 295, 297, |
Peptide sequence:
| >I XVVX |
Receptor sequence(s):
| >E AASGVATNTPTANDEEYITPVTIGGTTLNLNFDTGSADLWVFSTELPASQQSGHSVYNPSATGKELSGYTWSISYGDGSSASGNVFTDSVTVGGVTAHGQ AVQAAQQISAQFQQDTNNDGLLGLAFSSINTVQPQSQTTFFDTVKSSLAQPLFAVALKHQQPGVYDFGFIDSSKYTGSLTYTGVDNSQGFWSFNVDSYTA GSQSGDGFSGIADTGTTLLLLDDSVVSQYYSQVSGAQQDSNAGGYVFDCSTNLPDFSVSISGYTATVPGSLINYGPSGDGSTCLGGIQSNSGIGFSIFGD IFLKSQYVVFDSDGPQLGFAPQA |
The pepBDB database is updated monthly. Current version: 2020-03-18