View the peptide-receptor complex
|
PDB code: 1AQ5 Peptide ID: 1aq5_A Representation: Peptide: ball and stick Protein: cartoon Download files: receptor.pdb peptide.pdb complex.pdb binding data |
Protein style
Protein color
Pure Rainbow Peptide style Peptide color Pure Rainbow Action |
Interacting peptide residues:
| A: 9, 10, 11, 14, 15, 17, 18, 19, 21, 22, 24, 25, 27, 28, 29, 31, 32, 35, 36, 38, 39, 41, 42, 43, 45, 46, |
Interacting receptor residues:
| B: 9, 10, 13, 14, 15, 17, 18, 21, 24, 25, 27, 28, 31, 32, 35, 38, 39, 41, 42, 45, 46, C: 11, 14, 15, 18, 19, 21, 22, 25, 28, 29, 32, 35, 36, 39, 42, 43, 46, |
Peptide sequence:
| >A GSHMEEDPCECKSIVKFQTKVEELINTLQQKLEAVAKRIEALENKII |
Receptor sequence(s):
| >B GSHMEEDPCECKSIVKFQTKVEELINTLQQKLEAVAKRIEALENKII >C GSHMEEDPCECKSIVKFQTKVEELINTLQQKLEAVAKRIEALENKII |
The pepBDB database is updated monthly. Current version: 2020-03-18