View the peptide-receptor complex
|
PDB code: 1AQC Peptide ID: 1aqc_C Representation: Peptide: ball and stick Protein: cartoon Download files: receptor.pdb peptide.pdb complex.pdb binding data |
Protein style
Protein color
Pure Rainbow Peptide style Peptide color Pure Rainbow Action |
Interacting peptide residues:
| C: 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, |
Interacting receptor residues:
| A: 346, 347, 348, 353, 354, 413, 414, 415, 416, 417, 418, 419, 420, 421, 431, 456, 458, 472, 473, 476, 479, 482, 483, 486, |
Peptide sequence:
| >C GYENPTYKFF |
Receptor sequence(s):
| >A XEDLIDGIIFAANYLGSTQLLSDKTPSKNVRXXQAQEAVSRIKXAQKLXTEVDLFILTQRIKVLNADTQETXXDHPLRTISYIADIGNIVVLXARRRYKX ICHVFESEDAQLIAQSIGQAFSVAYQEFLR |
The pepBDB database is updated monthly. Current version: 2020-03-18