View the peptide-receptor complex
|
PDB code: 1AVP Peptide ID: 1avp_B Representation: Peptide: ball and stick Protein: cartoon Download files: receptor.pdb peptide.pdb complex.pdb binding data |
Protein style
Protein color
Pure Rainbow Peptide style Peptide color Pure Rainbow Action |
Interacting peptide residues:
| B: 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, |
Interacting receptor residues:
| A: 70, 77, 88, 89, 92, 93, 96, 97, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 114, 141, 142, 147, 148, 150, 151, 152, |
Peptide sequence:
| >B GVQSLKRRRCF |
Receptor sequence(s):
| >A MGSSEQELKAIVKDLGCGPYFLGTYDKRFPGFVSPHKLACAIVNTAGRETGGVHWMAFAWNPRSKTCYLFEPFGFSDQRLKQVYQFEYESLLRRSAIASS PDRCITLEKSTQSVQGPNSAACGLFCCMFLHAFANWPQTPMDHNPTMNLITGVPNSMLNSPQVQPTLRRNQEQLYSFLERHSPYFRSHSAQIRSATSFCH LKNM |
The pepBDB database is updated monthly. Current version: 2020-03-18