View the peptide-receptor complex
|
PDB code: 1AWR Peptide ID: 1awr_H Representation: Peptide: ball and stick Protein: cartoon Download files: receptor.pdb peptide.pdb complex.pdb binding data |
Protein style
Protein color
Pure Rainbow Peptide style Peptide color Pure Rainbow Action |
Interacting peptide residues:
| H: 101, 102, 103, 104, 105, 106, |
Interacting receptor residues:
| B: 1055, 1057, 1060, 1061, 1063, 1071, 1072, 1073, 1101, 1102, 1103, 1111, 1113, 1121, 1122, 1125, 1126, |
Peptide sequence:
| >H HAGPIA |
Receptor sequence(s):
| >B VNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMA NAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE |
The pepBDB database is updated monthly. Current version: 2020-03-18