View the peptide-receptor complex
|
PDB code: 1AXC Peptide ID: 1axc_B Representation: Peptide: ball and stick Protein: cartoon Download files: receptor.pdb peptide.pdb complex.pdb binding data |
Protein style
Protein color
Pure Rainbow Peptide style Peptide color Pure Rainbow Action |
Interacting peptide residues:
| B: 143, 144, 145, 146, 147, 148, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, |
Interacting receptor residues:
| A: 27, 29, 40, 43, 44, 45, 46, 47, 67, 68, 69, 96, 97, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 131, 133, 208, 211, 232, 233, 234, 250, 251, 252, 253, 254, 255, |
Peptide sequence:
| >B RQTSMTDFYHSKRRLIFS |
Receptor sequence(s):
| >A MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLA LVFEAPEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSEEEAVTIEMNEPVQLT FALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKI |
The pepBDB database is updated monthly. Current version: 2020-03-18