View the peptide-receptor complex
|
PDB code: 1AYB Peptide ID: 1ayb_P Representation: Peptide: ball and stick Protein: cartoon Download files: receptor.pdb peptide.pdb complex.pdb binding data |
Protein style
Protein color
Pure Rainbow Peptide style Peptide color Pure Rainbow Action |
Interacting peptide residues:
| P: -2, -1, 0, 1, 2, 3, 4, 5, |
Interacting receptor residues:
| A: 17, 32, 33, 34, 35, 36, 37, 42, 47, 51, 52, 53, 54, 55, 65, 66, 67, 68, 81, 87, 88, 89, 90, 91, 96, |
Peptide sequence:
| >P GEXVNIEF |
Receptor sequence(s):
| >A RRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTGDYYDLYGGEKFATLAELVQYYMEHHGQLKEKNGDVIELKYPLN |
The pepBDB database is updated monthly. Current version: 2020-03-18