View the peptide-receptor complex
|
PDB code: 1B01 Peptide ID: 1b01_A Representation: Peptide: ball and stick Protein: cartoon Download files: receptor.pdb peptide.pdb complex.pdb binding data |
Protein style
Protein color
Pure Rainbow Peptide style Peptide color Pure Rainbow Action |
Interacting peptide residues:
| A: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 13, 14, 16, 17, 20, 24, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 38, 39, 40, 43, |
Interacting receptor residues:
| B: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 16, 17, 20, 24, 28, 29, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, E: 102, 103, 104, 105, 106, 107, 108, 112, 113, 114, 115, 116, 117, F: 101, 102, 103, 104, 105, 106, 107, 111, 112, 113, 114, 115, 116, |
Peptide sequence:
| >A MKKRLTITLSESVLENLEKMAREMGLSKSAMISVALENYKKGQ |
Receptor sequence(s):
| >E CCCGTGCACTCAATGCAAT >F GATTGCATTGAGTGCACGG >B MKKRLTITLSESVLENLEKMAREMGLSKSAMISVALENYKKGQ |
The pepBDB database is updated monthly. Current version: 2020-03-18