View the peptide-receptor complex
|
PDB code: 1B07 Peptide ID: 1b07_C Representation: Peptide: ball and stick Protein: cartoon Download files: receptor.pdb peptide.pdb complex.pdb binding data |
Protein style
Protein color
Pure Rainbow Peptide style Peptide color Pure Rainbow Action |
Interacting peptide residues:
| C: 4, 5, 6, 7, 8, 9, 10, 11, |
Interacting receptor residues:
| A: 141, 143, 146, 147, 150, 166, 168, 169, 183, 184, 185, 186, |
Peptide sequence:
| >C EVPGPVPPRR |
Receptor sequence(s):
| >A SAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYH |
The pepBDB database is updated monthly. Current version: 2020-03-18