View the peptide-receptor complex
|
PDB code: 1B0R Peptide ID: 1b0r_C Representation: Peptide: ball and stick Protein: cartoon Download files: receptor.pdb peptide.pdb complex.pdb binding data |
Protein style
Protein color
Pure Rainbow Peptide style Peptide color Pure Rainbow Action |
Interacting peptide residues:
| C: 701, 702, 703, 706, 707, 708, 709, |
Interacting receptor residues:
| A: 5, 7, 9, 45, 59, 63, 66, 67, 69, 70, 73, 74, 76, 77, 80, 81, 84, 97, 99, 114, 116, 123, 124, 143, 147, 152, 155, 156, 159, 167, 171, |
Peptide sequence:
| >C GILVFTX |
Receptor sequence(s):
| >A GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYG CDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEAT LRCWALSFYPAEITLTWQRQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLPKPLTLRWE |
The pepBDB database is updated monthly. Current version: 2020-03-18