View the peptide-receptor complex
|
PDB code: 1B8H Peptide ID: 1b8h_D Representation: Peptide: ball and stick Protein: cartoon Download files: receptor.pdb peptide.pdb complex.pdb binding data |
Protein style
Protein color
Pure Rainbow Peptide style Peptide color Pure Rainbow Action |
Interacting peptide residues:
| D: 893, 894, 895, 896, 897, 898, 899, 900, 901, 902, 903, |
Interacting receptor residues:
| B: 32, 35, 36, 37, 38, 39, 103, 104, 105, 106, 107, 108, 109, 110, 199, 204, 205, 206, 217, 218, 219, 220, 221, 222, |
Peptide sequence:
| >D KKASLFDMFDF |
Receptor sequence(s):
| >B MKLSKDTIAILKNFASINSGILLSQGKFIMTRAVNGTTYAEANISDEIDFDVALYDLNSFLSILSLVSDDAEISMHTDGNIKIADTRSTVYWPAADKSTI VFPNKPIQFPVASVITEIKAEDLQQLLRVSRGLQIDTIAITNKDGKIVINGYNKVEDSGLTRPKYSLTLTDYDGSNNFNFVINMANMKIQPGNYKVMLWG AGDKVAAKFESSQVSYVIAMEADSTHDF |
The pepBDB database is updated monthly. Current version: 2020-03-18