View the peptide-receptor complex
|
PDB code: 1B8Q Peptide ID: 1b8q_B Representation: Peptide: ball and stick Protein: cartoon Download files: receptor.pdb peptide.pdb complex.pdb binding data |
Protein style
Protein color
Pure Rainbow Peptide style Peptide color Pure Rainbow Action |
Interacting peptide residues:
| B: 3, 4, 5, 6, 7, |
Interacting receptor residues:
| A: 16, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 38, 39, 41, 71, 75, 78, 79, |
Peptide sequence:
| >B VVKVDSV |
Receptor sequence(s):
| >A GSHMIEPNVISVRLFKRKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGIASETHVVLILRGPEGFTTH LETTFTGDGTPKTIRVTQPLGPPTKAV |
The pepBDB database is updated monthly. Current version: 2020-03-18