View the peptide-receptor complex
|
PDB code: 1B9E Peptide ID: 1b9e_B Representation: Peptide: ball and stick Protein: cartoon Download files: receptor.pdb peptide.pdb complex.pdb binding data |
Protein style
Protein color
Pure Rainbow Peptide style Peptide color Pure Rainbow Action |
Interacting peptide residues:
| B: 8, 9, 12, 13, 16, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, |
Interacting receptor residues:
| C: 21, D: 8, 9, 12, 13, 16, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, |
Peptide sequence:
| >B FVNQHLCGEHLVEALYLVCGERGFFYTPKT |
Receptor sequence(s):
| >C GIVEQCCTSICSLYQLENYCN >D FVNQHLCGEHLVEALYLVCGERGFFYTPKT |
The pepBDB database is updated monthly. Current version: 2020-03-18