View the peptide-receptor complex
|
PDB code: 1BBZ Peptide ID: 1bbz_B Representation: Peptide: ball and stick Protein: cartoon Download files: receptor.pdb peptide.pdb complex.pdb binding data |
Protein style
Protein color
Pure Rainbow Peptide style Peptide color Pure Rainbow Action |
Interacting peptide residues:
| B: 1, 2, 4, 5, 6, 7, 8, 9, 10, |
Interacting receptor residues:
| A: 7, 9, 12, 13, 14, 16, 31, 35, 36, 47, 49, 51, 52, |
Peptide sequence:
| >B APSYSPPPPP |
Receptor sequence(s):
| >A NLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVNS |
The pepBDB database is updated monthly. Current version: 2020-03-18