View the peptide-receptor complex
|
PDB code: 1BCK Peptide ID: 1bck_C Representation: Peptide: ball and stick Protein: cartoon Download files: receptor.pdb peptide.pdb complex.pdb binding data |
Protein style
Protein color
Pure Rainbow Peptide style Peptide color Pure Rainbow Action |
Interacting peptide residues:
| C: 2, 3, 4, 5, 6, 7, 8, 9, |
Interacting receptor residues:
| A: 55, 57, 60, 61, 63, 72, 73, 101, 102, 103, 104, 111, 113, 121, 122, 125, 126, |
Peptide sequence:
| >C XXXXXTXXVXA |
Receptor sequence(s):
| >A MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSM ANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE |
The pepBDB database is updated monthly. Current version: 2020-03-18