View the peptide-receptor complex
|
PDB code: 1BE9 Peptide ID: 1be9_B Representation: Peptide: ball and stick Protein: cartoon Download files: receptor.pdb peptide.pdb complex.pdb binding data |
Protein style
Protein color
Pure Rainbow Peptide style Peptide color Pure Rainbow Action |
Interacting peptide residues:
| B: 5, 6, 7, 8, 9, |
Interacting receptor residues:
| A: 318, 322, 323, 324, 325, 326, 327, 328, 329, 331, 339, 372, 376, 379, 380, |
Peptide sequence:
| >B KQTSV |
Receptor sequence(s):
| >A FLGEEDIPREPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRF EANSRVNSSGRIVTN |
The pepBDB database is updated monthly. Current version: 2020-03-18