View the peptide-receptor complex
|
PDB code: 1BH9 Peptide ID: 1bh9_A Representation: Peptide: ball and stick Protein: cartoon Download files: receptor.pdb peptide.pdb complex.pdb binding data |
Protein style
Protein color
Pure Rainbow Peptide style Peptide color Pure Rainbow Action |
Interacting peptide residues:
| A: 31, 32, 35, 36, 38, 39, 40, 41, 42, 43, 44, 45, 46, 48, 49, 50, 52, 53, 56, 57, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 73, |
Interacting receptor residues:
| B: 116, 119, 120, 123, 124, 127, 128, 129, 130, 133, 134, 137, 138, 141, 142, 154, 157, 158, 159, 161, 162, 163, 165, 166, 170, 180, 181, 182, 183, 184, 187, 188, 191, 195, 201, |
Peptide sequence:
| >A LFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSI |
Receptor sequence(s):
| >B FSEEQLNRYEMYRRSAFPKAAIKRLIQSITGTSVSQNVVIAMSGISKVFVGEVVEEALDVCEKWGEMPPLQPKHMREAVRRLKSKGQIP |
The pepBDB database is updated monthly. Current version: 2020-03-18