View the peptide-receptor complex
|
PDB code: 1BHX Peptide ID: 1bhx_E Representation: Peptide: ball and stick Protein: cartoon Download files: receptor.pdb peptide.pdb complex.pdb binding data |
Protein style
Protein color
Pure Rainbow Peptide style Peptide color Pure Rainbow Action |
Interacting peptide residues:
| E: 55, 56, 57, 58, 59, |
Interacting receptor residues:
| B: 32, 34, 38, 39, 40, 65, 67, 73, 74, 75, 76, 82, F: 151, |
Peptide sequence:
| >E DFEEI |
Receptor sequence(s):
| >B IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDI ALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKET >F GQPSVLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDSGGPFVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVI DQFGE |
The pepBDB database is updated monthly. Current version: 2020-03-18