View the peptide-receptor complex
PDB code: 1BI6 Peptide ID: 1bi6_L Representation: Peptide: ball and stick Protein: cartoon Download files: receptor.pdb peptide.pdb complex.pdb binding data |
Protein style
Protein color
Pure Rainbow Peptide style Peptide color Pure Rainbow Action |
L: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, |
H: 1, 2, 4, 5, 6, 7, 8, 9, 10, 11, 17, 34, 35, 38, 39, 40, 41, |
>L TACSECVCPLR |
>H EEYKCYCTDTYSDCPGFCKTCKAEFGKYICLDLISPNDCVK |