View the peptide-receptor complex
|
PDB code: 1BM2 Peptide ID: 1bm2_L Representation: Peptide: ball and stick Protein: cartoon Download files: receptor.pdb peptide.pdb complex.pdb binding data |
Protein style
Protein color
Pure Rainbow Peptide style Peptide color Pure Rainbow Action |
Interacting peptide residues:
| L: 2, 3, 4, 5, 6, |
Interacting receptor residues:
| A: 67, 86, 88, 89, 90, 91, 96, 106, 107, 108, 109, 111, 119, 120, 121, 141, 143, |
Peptide sequence:
| >L XXVNVP |
Receptor sequence(s):
| >A MKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIE |
The pepBDB database is updated monthly. Current version: 2020-03-18