View the peptide-receptor complex
|
PDB code: 1BMB Peptide ID: 1bmb_I Representation: Peptide: ball and stick Protein: cartoon Download files: receptor.pdb peptide.pdb complex.pdb binding data |
Protein style
Protein color
Pure Rainbow Peptide style Peptide color Pure Rainbow Action |
Interacting peptide residues:
| I: 2, 3, 4, 5, 6, 7, |
Interacting receptor residues:
| A: 67, 86, 88, 89, 90, 96, 106, 107, 108, 109, 111, 119, 120, 121, |
Peptide sequence:
| >I KPFXVNVEF |
Receptor sequence(s):
| >A KPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQ |
The pepBDB database is updated monthly. Current version: 2020-03-18