View the peptide-receptor complex
PDB code: 1BPH Peptide ID: 1bph_B Representation: Peptide: ball and stick Protein: cartoon Download files: receptor.pdb peptide.pdb complex.pdb binding data |
Protein style
Protein color
Pure Rainbow Peptide style Peptide color Pure Rainbow Action |
B: 2, 3, 4, 5, 6, 7, 11, 14, 15, 18, 19, 22, 23, 24, 25, 26, 27, 28, 30, |
A: 1, 2, 3, 6, 7, 8, 9, 10, 11, 12, 13, 16, 17, 18, 19, 20, 21, |
>B FVNQHLCGSHLVEALYLVCGERGFFYTPKA |
>A GIVEQCCASVCSLYQLENYCN |