View the peptide-receptor complex
|
PDB code: 1BXL Peptide ID: 1bxl_B Representation: Peptide: ball and stick Protein: cartoon Download files: receptor.pdb peptide.pdb complex.pdb binding data |
Protein style
Protein color
Pure Rainbow Peptide style Peptide color Pure Rainbow Action |
Interacting peptide residues:
| B: 572, 573, 574, 575, 576, 577, 578, 579, 580, 581, 584, 585, 586, 587, |
Interacting receptor residues:
| A: 97, 100, 101, 104, 105, 107, 108, 111, 112, 125, 126, 129, 130, 132, 137, 138, 139, 142, 143, 146, 194, 195, 199, 200, 203, 204, |
Peptide sequence:
| >B GQVGRQLAIIGDDINR |
Receptor sequence(s):
| >A MSMAMSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVN WGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERLEHHHHHH |
The pepBDB database is updated monthly. Current version: 2020-03-18