View the peptide-receptor complex
|
PDB code: 1BXP Peptide ID: 1bxp_B Representation: Peptide: ball and stick Protein: cartoon Download files: receptor.pdb peptide.pdb complex.pdb binding data |
Protein style
Protein color
Pure Rainbow Peptide style Peptide color Pure Rainbow Action |
Interacting peptide residues:
| B: 2, 3, 4, 5, 6, 7, 8, 11, 13, |
Interacting receptor residues:
| A: 6, 7, 9, 10, 11, 27, 29, 30, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 68, 69, 70, 71, 72, |
Peptide sequence:
| >B MRYYESSLKSYPD |
Receptor sequence(s):
| >A IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG |
The pepBDB database is updated monthly. Current version: 2020-03-18