View the peptide-receptor complex
|
PDB code: 1BXX Peptide ID: 1bxx_P Representation: Peptide: ball and stick Protein: cartoon Download files: receptor.pdb peptide.pdb complex.pdb binding data |
Protein style
Protein color
Pure Rainbow Peptide style Peptide color Pure Rainbow Action |
Interacting peptide residues:
| P: 1, 2, 3, 4, 5, 6, |
Interacting receptor residues:
| A: 174, 175, 176, 203, 393, 401, 402, 403, 404, 418, 419, 420, 421, 422, 423, 424, |
Peptide sequence:
| >P DYQRLN |
Receptor sequence(s):
| >A IGWRREGIKYRRNELFLDVLESVNLLMSPQGQVLSAHVSGRVVMKSYLSGMPECKFGMNDKIKQSIAIDDCTFHQCVRLSERSISFIPPDGEFELMRYRT TKDIILPFRVIPLVREVGRTKLEVKVVIKSNFKPSLLAQKIEVRIPTPLNTSGVQVICMKGKAKYKASENAIVWKIKRMAGMKESQISAEIELLPTNDKK KWARPPISMNFEVPFAPSGLKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYETRC |
The pepBDB database is updated monthly. Current version: 2020-03-18