View the peptide-receptor complex
|
PDB code: 1BZ9 Peptide ID: 1bz9_C Representation: Peptide: ball and stick Protein: cartoon Download files: receptor.pdb peptide.pdb complex.pdb binding data |
Protein style
Protein color
Pure Rainbow Peptide style Peptide color Pure Rainbow Action |
Interacting peptide residues:
| C: 1, 2, 3, 4, 6, 7, 8, 9, |
Interacting receptor residues:
| A: 5, 7, 9, 33, 45, 59, 62, 63, 66, 70, 72, 73, 76, 77, 80, 81, 84, 95, 99, 114, 116, 123, 133, 142, 143, 146, 147, 150, 152, 153, 156, 159, 163, 167, 171, |
Peptide sequence:
| >C FAPGVFPYM |
Receptor sequence(s):
| >A PHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGC DLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTL RCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRW |
The pepBDB database is updated monthly. Current version: 2020-03-18