View the peptide-receptor complex
|
PDB code: 1RGQ Peptide ID: 1rgq_C Representation: Peptide: ball and stick Protein: cartoon Download files: receptor.pdb peptide.pdb complex.pdb binding data |
Protein style
Protein color
Pure Rainbow Peptide style Peptide color Pure Rainbow Action |
Interacting peptide residues:
| C: 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, |
Interacting receptor residues:
| A: 32, 33, 34, 38, 110, 112, 113, 114, 116, B: 1, 6, 7, 8, 9, 10, 11, 12, 13, 14, 19, 22, 23, 24, 26, 28, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 45, 47, 62, 65, 66, 67, 68, 73, 88, 91, 95, 97, 110, 111, 112, 114, 145, 147, D: 28, 29, 30, 31, 32, 33, 35, |
Peptide sequence:
| >C KGSVVIVGRIVLSGKPAIIPKK |
Receptor sequence(s):
| >A QVEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLL SPRPISYLKGSSGGPLLCPAGHAVGLFRAAVCTRGVTKAVDFIPVENLETTMRS >B QMGAPITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPC TCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGLFRAAVCTRGVTKAVDFIPVENLETTMRSGS >D GSVVIVGRIVLSGKPAI |
The pepBDB database is updated monthly. Current version: 2020-03-18