View the peptide-receptor complex
|
PDB code: 1THR Peptide ID: 1thr_L Representation: Peptide: ball and stick Protein: cartoon Download files: receptor.pdb peptide.pdb complex.pdb binding data |
Protein style
Protein color
Pure Rainbow Peptide style Peptide color Pure Rainbow Action |
Interacting peptide residues:
| L: 1, 2, 3, 4, 5, 6, 7, 8, 9, 14, |
Interacting receptor residues:
| H: 23, 24, 25, 26, 27, 28, 29, 115, 116, 117, 119, 120, 121, 122, 129, 133, 134, 135, 136, 137, 159, 184, 186, 201, 202, 203, 204, 205, 206, 207, |
Peptide sequence:
| >L ADCGLRPLFEKKSLEDKTERELLESYI |
Receptor sequence(s):
| >H IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDI ALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKETGQPSVLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDSGG PFVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDQFGE |
The pepBDB database is updated monthly. Current version: 2020-03-18