View the peptide-receptor complex
PDB code: 3EYD Peptide ID: 3eyd_B Representation: Peptide: ball and stick Protein: cartoon Download files: receptor.pdb peptide.pdb complex.pdb binding data |
Protein style
Protein color
Pure Rainbow Peptide style Peptide color Pure Rainbow Action |
B: 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, |
A: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 16, 19, 20, 23, 25, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 42, 43, 44, 59, 62, 63, 64, 65, 70, 85, 88, 92, 94, 107, 108, 109, 110, 111, 142, 144, |
>B KGSVVIVGRIVLSGKPAIIPKK |
>A APITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCTCG SSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGLFRAAVCTRGVAKAVDFIPVENLETTMRS |